PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang11g06450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 213aa    MW: 23810.1 Da    PI: 6.5973
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang11g06450.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY125.95.7e-393617623170
           YABBY  23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvir 117
                      vsvP tslfk+vtvrCGhCt+ll vn++      +++ hl++s+  + ++ l+   +      +++ + s+s++ +   +   +e+pr+p ++r
  Vang11g06450.1  36 QVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLVPSPTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQANLSASNEFSLPARTAADELPRPPIINR 130
                     69******************************************999866666555555555555555555444443335666777786555444 PP

           YABBY 118 PPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          + vP    +  ++eiqrik+ nPdi+hreafsaaaknWahfP+ihfgl
  Vang11g06450.1 131 -----RPVPLVEEK--RDEIQRIKSVNPDITHREAFSAAAKNWAHFPHIHFGL 176
                     .....447776665..9**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.0E-3836176IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MDDDTVVFFG MRESHRAYMS MDGDASDRIF LRSMDQVSVP CTSLFKTVTV RCGHCTNLLP  60
VNMRGLLVPS PTQFHLGHSF FSPSHNLLEE IPNPSPNFLM NQANLSASNE FSLPARTAAD  120
ELPRPPIINR RPVPLVEEKR DEIQRIKSVN PDITHREAFS AAAKNWAHFP HIHFGLMPDQ  180
TVKKTNVCQQ EGEEVLMKDG FYASANVGVS PY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1464763e-91BT146476.1 Lotus japonicus clone JCVI-FLLj-18N7 unknown mRNA.
GenBankBT1484103e-91BT148410.1 Lotus japonicus clone JCVI-FLLj-6P15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549900.11e-114PREDICTED: protein YABBY 4-like isoform X1
SwissprotO221521e-54YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0B2PQ621e-114A0A0B2PQ62_GLYSO; Protein YABBY 5
TrEMBLI1MUX51e-114I1MUX5_SOYBN; Uncharacterized protein
STRINGGLYMA17G14710.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.17e-51YABBY family protein